NCF4 Antikörper (N-Term)
-
- Target Alle NCF4 Antikörper anzeigen
- NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NCF4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NCF4 antibody was raised against the N terminal of NCF4
- Aufreinigung
- Affinity purified
- Immunogen
- NCF4 antibody was raised using the N terminal of NCF4 corresponding to a region with amino acids SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE
- Top Product
- Discover our top product NCF4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NCF4 Blocking Peptide, catalog no. 33R-8572, is also available for use as a blocking control in assays to test for specificity of this NCF4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCF4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))
- Andere Bezeichnung
- NCF4 (NCF4 Produkte)
- Synonyme
- p40phox antikoerper, AI451400 antikoerper, NCF antikoerper, P40PHOX antikoerper, SH3PXD4 antikoerper, neutrophil cytosolic factor 4 antikoerper, ncf4 antikoerper, Ncf4 antikoerper, NCF4 antikoerper
- Hintergrund
- NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling event.
- Molekulargewicht
- 39 kDa (MW of target protein)
-