NCF4 Antikörper (N-Term)

Produktnummer ABIN634325

Der Kaninchen Polyklonal Anti-NCF4-Antikörper wurde für WB validiert. Er ist geeignet, NCF4 in Proben von Human zu detektieren.

Kurzübersicht für NCF4 Antikörper (N-Term) (ABIN634325)

Target: NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NCF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NCF4 Antikörper

Bindungsspezifität: N-Term

Spezifität: NCF4 antibody was raised against the N terminal of NCF4

Aufreinigung: Affinity purified

Immunogen: NCF4 antibody was raised using the N terminal of NCF4 corresponding to a region with amino acids SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NCF4 Blocking Peptide, (ABIN5614929), is also available for use as a blocking control in assays to test for specificity of this NCF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NCF4

Target: NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))

Andere Bezeichnung: NCF4

Hintergrund: NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling event.

Molekulargewicht: 39 kDa (MW of target protein)