SNX5 Antikörper (N-Term)

Produktnummer ABIN634321

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SNX5 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für SNX5 Antikörper (N-Term) (ABIN634321)

Target: SNX5 (Sorting Nexin 5 (SNX5))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNX5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SNX5 Antikörper

Bindungsspezifität: N-Term

Spezifität: SNX5 antibody was raised against the N terminal of SNX5

Aufreinigung: Affinity purified

Immunogen: SNX5 antibody was raised using the N terminal of SNX5 corresponding to a region with amino acids FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNX5 Blocking Peptide, (ABIN938512), is also available for use as a blocking control in assays to test for specificity of this SNX5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNX5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNX5

Target: SNX5 (Sorting Nexin 5 (SNX5))

Andere Bezeichnung: SNX5

Hintergrund: SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.

Molekulargewicht: 47 kDa (MW of target protein)