CHN1 Antikörper

Produktnummer ABIN634308

Produktdetails anti-CHN1 Antikörper

Target: CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CHN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHN1 Blocking Peptide, catalog no. 33R-4728, is also available for use as a blocking control in assays to test for specificity of this CHN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHN1

Target: CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))

Andere Bezeichnung: CHN1 (ARHGAP2 Produkte)

Synonyme: ARHGAP2 antikoerper, CHN antikoerper, DURS2 antikoerper, NC antikoerper, RHOGAP2 antikoerper, 0610007I19Rik antikoerper, 0710001E19Rik antikoerper, 1700112L09Rik antikoerper, 2900046J01Rik antikoerper, AI413815 antikoerper, chimaerin antikoerper, wu:fr89a09 antikoerper, zgc:56160 antikoerper, zgc:92906 antikoerper, N-chimaerin antikoerper, chimerin 1 antikoerper, chimerin 1 L homeolog antikoerper, CHN1 antikoerper, Chn1 antikoerper, chn1.L antikoerper, chn1 antikoerper

Hintergrund: CHN1 contains 1 phorbol-ester/DAG-type zinc finger, 1 Rho-GAP domain and 1 SH2 domain. CHN1 is a GTPase-activating protein for p21-rac and a phorbol ester receptor. It may play an important role in neuronal signal-transduction mechanisms.

Molekulargewicht: 53 kDa (MW of target protein)