RanBP3 Antikörper (N-Term)
-
- Target Alle RanBP3 (RANBP3) Antikörper anzeigen
- RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RanBP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RanBP3 antibody was raised against the N terminal of RANBP3
- Aufreinigung
- Affinity purified
- Immunogen
- RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH
- Top Product
- Discover our top product RANBP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RanBP3 Blocking Peptide, catalog no. 33R-5623, is also available for use as a blocking control in assays to test for specificity of this RanBP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANBP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))
- Andere Bezeichnung
- RanBP3 (RANBP3 Produkte)
- Hintergrund
- RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.
- Molekulargewicht
- 62 kDa (MW of target protein)
-