RanBP3 Antikörper (N-Term)

Produktnummer ABIN634299

Dieses Anti-RanBP3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RanBP3 in WB. Geeignet für Human.

Kurzübersicht für RanBP3 Antikörper (N-Term) (ABIN634299)

Target: RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RanBP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RanBP3 Antikörper

Bindungsspezifität: N-Term

Spezifität: RanBP3 antibody was raised against the N terminal of RANBP3

Aufreinigung: Affinity purified

Immunogen: RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RanBP3 Blocking Peptide, (ABIN5615753), is also available for use as a blocking control in assays to test for specificity of this RanBP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANBP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RanBP3

Target: RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))

Andere Bezeichnung: RanBP3

Hintergrund: RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.

Molekulargewicht: 62 kDa (MW of target protein)