ARF6 Antikörper (Middle Region)

Produktnummer ABIN634294

Produktdetails anti-ARF6 Antikörper

Target: ARF6 (ADP-Ribosylation Factor 6 (ARF6))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARF6 antibody was raised against the middle region of ARF6

Aufreinigung: Affinity purified

Immunogen: ARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARF6 Blocking Peptide, catalog no. 33R-7882, is also available for use as a blocking control in assays to test for specificity of this ARF6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARF6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARF6

Target: ARF6 (ADP-Ribosylation Factor 6 (ARF6))

Andere Bezeichnung: ARF6 (ARF6 Produkte)

Synonyme: AI788669 antikoerper, AW496366 antikoerper, MGC80156 antikoerper, arf6 antikoerper, wu:fj46d09 antikoerper, zgc:77665 antikoerper, wu:fa98a01 antikoerper, zgc:172028 antikoerper, ADP ribosylation factor 6 antikoerper, ADP-ribosylation factor 6 antikoerper, ADP ribosylation factor 6 L homeolog antikoerper, Arf6 protein antikoerper, ADP-ribosylation factor 6a antikoerper, ADP-ribosylation factor 6b antikoerper, ADP ribosylation factor like GTPase 6 antikoerper, ARF6 antikoerper, Arf6 antikoerper, arf6.2.L antikoerper, arf6 antikoerper, arf6a antikoerper, arf6b antikoerper, ARL6 antikoerper

Hintergrund: ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: Steroid Hormone Mediated Signaling Pathway, Regulation of Actin Filament Polymerization, SARS-CoV-2 Protein Interaktom