ARL5A Antikörper (Middle Region)

Produktnummer ABIN634288

Produktdetails anti-ARL5A Antikörper

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARL5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARL5 A antibody was raised against the middle region of ARL5

Aufreinigung: Affinity purified

Immunogen: ARL5 A antibody was raised using the middle region of ARL5 corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARL5A Blocking Peptide, catalog no. 33R-10153, is also available for use as a blocking control in assays to test for specificity of this ARL5A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARL5A

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Andere Bezeichnung: ARL5A (ARL5A Produkte)

Synonyme: arl8 antikoerper, MGC89392 antikoerper, ARL5A antikoerper, arl5a antikoerper, zgc:92193 antikoerper, ARFLP5 antikoerper, ARL5 antikoerper, 2410015N24Rik antikoerper, 2810410P22Rik antikoerper, AA408731 antikoerper, AW610751 antikoerper, Arl5 antikoerper, T25534 antikoerper, ADP ribosylation factor like GTPase 5B antikoerper, ADP ribosylation factor like GTPase 5A antikoerper, ADP-ribosylation factor-like 5A antikoerper, ADP ribosylation factor like GTPase 5B S homeolog antikoerper, ADP-ribosylation factor like GTPase 5A antikoerper, ADP-ribosylation factor-like protein 5 antikoerper, arl5b antikoerper, ARL5A antikoerper, arl5a antikoerper, arl5b.S antikoerper, Arl5a antikoerper, arl-5 antikoerper

Hintergrund: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Molekulargewicht: 20 kDa (MW of target protein)