ARL5A Antikörper (Middle Region)

Produktnummer ABIN634288

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch ARL5A in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ARL5A Antikörper (Middle Region) (ABIN634288)

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARL5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ARL5A Antikörper

Bindungsspezifität: Middle Region

Spezifität: ARL5 A antibody was raised against the middle region of ARL5

Aufreinigung: Affinity purified

Immunogen: ARL5 A antibody was raised using the middle region of ARL5 corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARL5A Blocking Peptide, (ABIN936120), is also available for use as a blocking control in assays to test for specificity of this ARL5A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARL5A

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Andere Bezeichnung: ARL5A

Hintergrund: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Molekulargewicht: 20 kDa (MW of target protein)