ARL5A Antikörper (Middle Region)

Produktnummer ABIN634288

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ARL5A in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ARL5A Antikörper (Middle Region) (ABIN634288)

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARL5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ARL5A Antikörper

Bindungsspezifität: Middle Region

Spezifität: ARL5 A antibody was raised against the middle region of ARL5

Aufreinigung: Affinity purified

Immunogen: ARL5 A antibody was raised using the middle region of ARL5 corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARL5A Blocking Peptide, (ABIN936120), is also available for use as a blocking control in assays to test for specificity of this ARL5A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARL5A

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Andere Bezeichnung: ARL5A

Hintergrund: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Molekulargewicht: 20 kDa (MW of target protein)