ECT2 Antikörper (Middle Region)
-
- Target Alle ECT2 Antikörper anzeigen
- ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ECT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ECT2 antibody was raised against the middle region of ECT2
- Aufreinigung
- Affinity purified
- Immunogen
- ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG
- Top Product
- Discover our top product ECT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ECT2 Blocking Peptide, catalog no. 33R-4471, is also available for use as a blocking control in assays to test for specificity of this ECT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))
- Andere Bezeichnung
- ECT2 (ECT2 Produkte)
- Hintergrund
- ECT2 is a transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of ECT2 is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis.
- Molekulargewicht
- 100 kDa (MW of target protein)
- Pathways
- Neurotrophin Signalübertragung, Cell-Cell Junction Organization
-