FICD Antikörper (C-Term)

Produktnummer ABIN634275

Dieses Anti-FICD-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FICD in WB und IHC. Geeignet für Human.

Kurzübersicht für FICD Antikörper (C-Term) (ABIN634275)

Target: FICD (FIC Domain Containing (FICD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FICD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-FICD Antikörper

Bindungsspezifität: C-Term

Spezifität: FICD antibody was raised against the C terminal of FICD

Aufreinigung: Affinity purified

Immunogen: FICD antibody was raised using the C terminal of FICD corresponding to a region with amino acids GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FICD Blocking Peptide, (ABIN938601), is also available for use as a blocking control in assays to test for specificity of this FICD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FICD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FICD

Target: FICD (FIC Domain Containing (FICD))

Andere Bezeichnung: FICD

Hintergrund: FICD is an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. It is able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.

Molekulargewicht: 52 kDa (MW of target protein)