SUN2 Antikörper

Produktnummer ABIN634274

Der Kaninchen Polyklonal anti-SUN2 Antikörper wird verwendet zum Nachweis von SUN2 in Proben von Human und Ratte. Er wurde validiert für WB.

Kurzübersicht für SUN2 Antikörper (ABIN634274)

Target: SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SUN2 Antikörper

Aufreinigung: Affinity purified

Immunogen: UNC84 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UNC84B Blocking Peptide, (ABIN5616914), is also available for use as a blocking control in assays to test for specificity of this UNC84B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SUN2

Target: SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))

Andere Bezeichnung: UNC84B

Hintergrund: UNC84B may form a physical interaction between the nuclear envelope and the centrosome.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion