TGFB3 Antikörper (Middle Region)

Produktnummer ABIN634272

Produktdetails anti-TGFB3 Antikörper

Target: TGFB3 (Transforming Growth Factor, beta 3 (TGFB3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TGFB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TGF beta 3 antibody was raised against the middle region of TGFB3

Aufreinigung: Affinity purified

Immunogen: TGF beta 3 antibody was raised using the middle region of TGFB3 corresponding to a region with amino acids DFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TGF beta 3 Blocking Peptide, catalog no. 33R-1938, is also available for use as a blocking control in assays to test for specificity of this TGF beta 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TGFB3

Target: TGFB3 (Transforming Growth Factor, beta 3 (TGFB3))

Andere Bezeichnung: TGF beta 3 (TGFB3 Produkte)

Synonyme: TGFB3 antikoerper, ARVD antikoerper, TGF-beta3 antikoerper, Tgfb-3 antikoerper, TGF-B3 antikoerper, TGFbeta3 antikoerper, wu:fc78g09 antikoerper, zgc:92058 antikoerper, transforming growth factor beta 3 antikoerper, transforming growth factor, beta 3 antikoerper, TGFB3 antikoerper, Tgfb3 antikoerper, tgfb3 antikoerper

Hintergrund: TGFB3 is involved in embryogenesis and cell differentiation.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus