LZTS2 Antikörper (N-Term)

Produktnummer ABIN634260

Produktdetails anti-LZTS2 Antikörper

Target: LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LZTS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LZTS2 antibody was raised against the N terminal of LZTS2

Aufreinigung: Affinity purified

Immunogen: LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LZTS2 Blocking Peptide, catalog no. 33R-2636, is also available for use as a blocking control in assays to test for specificity of this LZTS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LZTS2

Target: LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))

Andere Bezeichnung: LZTS2 (LZTS2 Produkte)

Synonyme: lapser1 antikoerper, MGC89253 antikoerper, si:dkey-250a11.1 antikoerper, LAPSER1 antikoerper, BC014695 antikoerper, mKIAA1813 antikoerper, Lapser1 antikoerper, leucine zipper, putative tumor suppressor 2 antikoerper, leucine zipper tumor suppressor 2 antikoerper, leucine zipper, putative tumor suppressor 2a antikoerper, leucine zipper, putative tumor suppressor 2 S homeolog antikoerper, lzts2 antikoerper, LZTS2 antikoerper, lzts2a antikoerper, Lzts2 antikoerper, lzts2.S antikoerper

Hintergrund: LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis.

Molekulargewicht: 73 kDa (MW of target protein)