LZTS2 Antikörper (N-Term)

Produktnummer ABIN634260

Der Kaninchen Polyklonal anti-LZTS2 Antikörper (ABIN634260) detektiert spezifisch LZTS2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für LZTS2 Antikörper (N-Term) (ABIN634260)

Target: LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LZTS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LZTS2 Antikörper

Bindungsspezifität: N-Term

Spezifität: LZTS2 antibody was raised against the N terminal of LZTS2

Aufreinigung: Affinity purified

Immunogen: LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LZTS2 Blocking Peptide, (ABIN938022), is also available for use as a blocking control in assays to test for specificity of this LZTS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LZTS2

Target: LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))

Andere Bezeichnung: LZTS2

Hintergrund: LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis.

Molekulargewicht: 73 kDa (MW of target protein)