Factor II Antikörper

Produktnummer ABIN634257

Produktdetails

Target: Factor II

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids KYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Factor II Blocking Peptide, catalog no. 33R-4737, is also available for use as a blocking control in assays to test for specificity of this Factor II antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Factor II

Hintergrund: Coagulation factor II receptor(F2R) is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member.

Molekulargewicht: 47 kDa (MW of target protein)