Estrogen Receptor alpha Antikörper (Middle Region)
-
- Target Alle Estrogen Receptor alpha (ESR1) Antikörper anzeigen
- Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Estrogen Receptor alpha Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Estrogen Receptor 1 antibody was raised against the middle region of ESR1
- Aufreinigung
- Affinity purified
- Immunogen
- Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE
- Top Product
- Discover our top product ESR1 Primärantikörper
-
anti-Estrogen Receptor 1 (ESR1) (AA 246-273) antibody
ESR1 Reaktivität: Human, Maus WB, IF, IHC (p) Wirt: Kaninchen Polyclonal RB33807 unconjugated
anti-Estrogen Receptor 1 (ESR1) (AA 129-312) antibodyESR1 Reaktivität: Human IHC, IF, FACS, StM Wirt: Maus Monoclonal ESR1-3557 unconjugated
anti-Estrogen Receptor 1 (ESR1) (AA 2-185) antibodyESR1 Reaktivität: Human WB, IHC, ELISA, FACS, ICC Wirt: Maus Monoclonal 6A6E8 unconjugated
anti-Estrogen Receptor 1 (ESR1) antibodyESR1 Reaktivität: Human WB, IHC, StM Wirt: Maus Monoclonal ESR1-1904 unconjugated
anti-Estrogen Receptor 1 (ESR1) (pSer167) antibodyESR1 Reaktivität: Human, Ratte ELISA, FACS, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Estrogen Receptor 1 (ESR1) (AA 2-185) antibodyESR1 Reaktivität: Human WB, IHC, FACS, StM Wirt: Maus Monoclonal ER506 unconjugated
anti-Estrogen Receptor 1 (ESR1) (C-Term) antibodyESR1 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Estrogen Receptor 1 (ESR1) (AA 246-273) antibodyESR1 Reaktivität: Human WB, IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Estrogen Receptor 1 (ESR1) (AA 233-483) antibodyESR1 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Estrogen Receptor 1 (ESR1) (pSer118) antibodyESR1 Reaktivität: Human, Maus, Ratte WB, ELISA, FACS, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Estrogen Receptor 1 Blocking Peptide, catalog no. 33R-5132, is also available for use as a blocking control in assays to test for specificity of this Estrogen Receptor 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))
- Andere Bezeichnung
- Estrogen Receptor 1 (ESR1 Produkte)
- Hintergrund
- Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.
- Molekulargewicht
- 66 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-
