Factor II Antikörper

Produktnummer ABIN634253

Der Kaninchen Polyklonal Anti--Antikörper wurde für WB validiert. Er ist geeignet, in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Factor II Antikörper (ABIN634253)

Target: Factor II

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Produktdetails

Aufreinigung: Affinity purified

Immunogen: Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Factor II Blocking Peptide, (ABIN939531), is also available for use as a blocking control in assays to test for specificity of this Factor II antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Factor II

Hintergrund: Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life. Mutations in F2 leads to various forms of thrombosis and dysprothrombinemia.

Molekulargewicht: 65 kDa (MW of target protein)