RBM14 Antikörper (N-Term)

Produktnummer ABIN634248

Produktdetails anti-RBM14 Antikörper

Target: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBM14 antibody was raised against the N terminal of RBM14

Aufreinigung: Affinity purified

Immunogen: RBM14 antibody was raised using the N terminal of RBM14 corresponding to a region with amino acids YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM14 Blocking Peptide, catalog no. 33R-10047, is also available for use as a blocking control in assays to test for specificity of this RBM14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM14

Target: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Andere Bezeichnung: RBM14 (RBM14 Produkte)

Synonyme: im:7053198 antikoerper, wu:fc08a04 antikoerper, zgc:110682 antikoerper, sip antikoerper, coaa antikoerper, psp2 antikoerper, sytip1 antikoerper, tmem137 antikoerper, MGC52864 antikoerper, MGC132117 antikoerper, MGC75876 antikoerper, RBM14 antikoerper, RBM4 antikoerper, COAA antikoerper, PSP2 antikoerper, SIP antikoerper, SYTIP1 antikoerper, TMEM137 antikoerper, 1300007E16Rik antikoerper, Sytip antikoerper, p16 antikoerper, p16K antikoerper, CoAA antikoerper, rbm14 antikoerper, zgc:85696 antikoerper, RNA binding motif protein 14a antikoerper, RNA binding motif protein 14 L homeolog antikoerper, RNA binding motif protein 14 antikoerper, RNA binding motif protein 14b antikoerper, rbm14a antikoerper, rbm14.L antikoerper, rbm14 antikoerper, RBM14 antikoerper, Rbm14 antikoerper, rbm14b antikoerper

Hintergrund: RBM14 contains 2 RRM (RNA recognition motif) domains. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

Molekulargewicht: 69 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway