RBM14 Antikörper (N-Term)

Produktnummer ABIN634248

Dieses Anti-RBM14-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RBM14 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für RBM14 Antikörper (N-Term) (ABIN634248)

Target: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBM14 Antikörper

Bindungsspezifität: N-Term

Spezifität: RBM14 antibody was raised against the N terminal of RBM14

Aufreinigung: Affinity purified

Immunogen: RBM14 antibody was raised using the N terminal of RBM14 corresponding to a region with amino acids YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM14 Blocking Peptide, (ABIN936003), is also available for use as a blocking control in assays to test for specificity of this RBM14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM14

Target: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Andere Bezeichnung: RBM14

Hintergrund: RBM14 contains 2 RRM (RNA recognition motif) domains. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

Molekulargewicht: 69 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway