PP5 Antikörper (N-Term)

Produktnummer ABIN634245

Dieses Anti-PP5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PP5 in WB. Geeignet für Human und Maus.

Kurzübersicht für PP5 Antikörper (N-Term) (ABIN634245)

Target: PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PP5 Antikörper

Bindungsspezifität: N-Term

Spezifität: PPP5 C antibody was raised against the N terminal of PPP5

Aufreinigung: Affinity purified

Immunogen: PPP5 C antibody was raised using the N terminal of PPP5 corresponding to a region with amino acids MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP5C Blocking Peptide, (ABIN5615528), is also available for use as a blocking control in assays to test for specificity of this PPP5C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PP5

Target: PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))

Andere Bezeichnung: PPP5C

Hintergrund: PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

Molekulargewicht: 57 kDa (MW of target protein)