PP5 Antikörper (N-Term)
-
- Target Alle PP5 (PPP5C) Antikörper anzeigen
- PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PP5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PPP5 C antibody was raised against the N terminal of PPP5
- Aufreinigung
- Affinity purified
- Immunogen
- PPP5 C antibody was raised using the N terminal of PPP5 corresponding to a region with amino acids MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF
- Top Product
- Discover our top product PPP5C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPP5C Blocking Peptide, catalog no. 33R-5701, is also available for use as a blocking control in assays to test for specificity of this PPP5C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))
- Andere Bezeichnung
- PPP5C (PPP5C Produkte)
- Hintergrund
- PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.
- Molekulargewicht
- 57 kDa (MW of target protein)
-