KIF13B Antikörper (N-Term)

Produktnummer ABIN634243

Produktdetails anti-KIF13B Antikörper

Target: KIF13B (Kinesin Family Member 13B (KIF13B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF13B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIF13 B antibody was raised against the N terminal of KIF13

Aufreinigung: Affinity purified

Immunogen: KIF13 B antibody was raised using the N terminal of KIF13 corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF13B Blocking Peptide, catalog no. 33R-8472, is also available for use as a blocking control in assays to test for specificity of this KIF13B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF13B

Target: KIF13B (Kinesin Family Member 13B (KIF13B))

Andere Bezeichnung: KIF13B (KIF13B Produkte)

Synonyme: kif13b antikoerper, xKIF13b antikoerper, GAKIN antikoerper, 5330429L19Rik antikoerper, 6030414C01 antikoerper, AI429803 antikoerper, C130021D12Rik antikoerper, kinesin family member 13Ba antikoerper, kinesin family member 13B L homeolog antikoerper, kinesin family member 13B antikoerper, kif13ba antikoerper, kif13b.L antikoerper, KIF13B antikoerper, Kif13b antikoerper

Hintergrund: KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.

Molekulargewicht: 203 kDa (MW of target protein)