TLK1 Antikörper (N-Term)

Produktnummer ABIN634240

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TLK1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für TLK1 Antikörper (N-Term) (ABIN634240)

Target: TLK1 (Tousled-Like Kinase 1 (TLK1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TLK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TLK1 Antikörper

Bindungsspezifität: N-Term

Spezifität: TLK1 antibody was raised against the N terminal of TLK1

Aufreinigung: Affinity purified

Immunogen: TLK1 antibody was raised using the N terminal of TLK1 corresponding to a region with amino acids ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TLK1 Blocking Peptide, (ABIN938110), is also available for use as a blocking control in assays to test for specificity of this TLK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TLK1

Target: TLK1 (Tousled-Like Kinase 1 (TLK1))

Andere Bezeichnung: TLK1

Hintergrund: The Tousled-like kinases, first described in Arabadopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.

Molekulargewicht: 84 kDa (MW of target protein)