FRK Antikörper (N-Term)

Produktnummer ABIN634237

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FRK in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für FRK Antikörper (N-Term) (ABIN634237)

Target: FRK (Fyn-Related Kinase (FRK))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FRK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FRK Antikörper

Bindungsspezifität: N-Term

Spezifität: FRK antibody was raised against the N terminal of FRK

Aufreinigung: Affinity purified

Immunogen: FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FRK Blocking Peptide, (ABIN940218), is also available for use as a blocking control in assays to test for specificity of this FRK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FRK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FRK

Target: FRK (Fyn-Related Kinase (FRK))

Andere Bezeichnung: FRK

Hintergrund: The specific function of FRK is not yet known.

Molekulargewicht: 58 kDa (MW of target protein)