HDAC9 Antikörper (Middle Region)
-
- Target Alle HDAC9 Antikörper anzeigen
- HDAC9 (Histone Deacetylase 9 (HDAC9))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HDAC9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HDAC9 antibody was raised against the middle region of HDAC9
- Aufreinigung
- Affinity purified
- Immunogen
- HDAC9 antibody was raised using the middle region of HDAC9 corresponding to a region with amino acids GQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVI
- Top Product
- Discover our top product HDAC9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HDAC9 Blocking Peptide, catalog no. 33R-3517, is also available for use as a blocking control in assays to test for specificity of this HDAC9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDAC9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HDAC9 (Histone Deacetylase 9 (HDAC9))
- Andere Bezeichnung
- HDAC9 (HDAC9 Produkte)
- Synonyme
- HD7 antikoerper, HD7b antikoerper, HD9 antikoerper, HDAC antikoerper, HDAC7 antikoerper, HDAC7B antikoerper, HDAC9B antikoerper, HDAC9FL antikoerper, HDRP antikoerper, MITR antikoerper, AV022454 antikoerper, D030072B18Rik antikoerper, HD7B antikoerper, Hdac7b antikoerper, Mitr antikoerper, mKIAA0744 antikoerper, hdac9 antikoerper, zgc:73392 antikoerper, TWIST antikoerper, HDAC9 antikoerper, DKFZp459E171 antikoerper, HDA09 antikoerper, HISTONE DEACETYLASE antikoerper, histone deacetylase 9 antikoerper, RGD1310748 antikoerper, RGD1563092 antikoerper, hdac9-A antikoerper, histone deacetylase 9 antikoerper, histone deacetylase 9b antikoerper, histone deacetylase 9 S homeolog antikoerper, HDAC9 antikoerper, Hdac9 antikoerper, hdac9b antikoerper, HDA9 antikoerper, hdac9.S antikoerper
- Hintergrund
- Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.
- Molekulargewicht
- 66 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-