NDN Antikörper

Produktnummer ABIN634231

Produktdetails anti-NDN Antikörper

Target: NDN (Necdin Homolog (Mouse) (NDN))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NDN antibody was raised using a synthetic peptide corresponding to a region with amino acids VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDN Blocking Peptide, catalog no. 33R-9426, is also available for use as a blocking control in assays to test for specificity of this NDN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDN

Target: NDN (Necdin Homolog (Mouse) (NDN))

Andere Bezeichnung: NDN (NDN Produkte)

Synonyme: LOC574323 antikoerper, AI528698 antikoerper, Peg6 antikoerper, NDN antikoerper, HsT16328 antikoerper, PWCR antikoerper, necdin, MAGE family member antikoerper, necdin antikoerper, NDN antikoerper, Ndn antikoerper

Hintergrund: This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung