MCTS1 Antikörper (N-Term)

Produktnummer ABIN634224

Der Kaninchen Polyklonal anti-MCTS1 Antikörper (ABIN634224) detektiert spezifisch MCTS1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für MCTS1 Antikörper (N-Term) (ABIN634224)

Target: MCTS1 (Malignant T Cell Amplified Sequence 1 (MCTS1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCTS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MCTS1 Antikörper

Bindungsspezifität: N-Term

Spezifität: MCTS1 antibody was raised against the N terminal of MCTS1

Aufreinigung: Affinity purified

Immunogen: MCTS1 antibody was raised using the N terminal of MCTS1 corresponding to a region with amino acids MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCTS1 Blocking Peptide, (ABIN5614708), is also available for use as a blocking control in assays to test for specificity of this MCTS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCTS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCTS1

Target: MCTS1 (Malignant T Cell Amplified Sequence 1 (MCTS1))

Andere Bezeichnung: MCTS1

Hintergrund: MCTS1 is an anti-oncogene that play a role in cell cycle regulation, decreases cell doubling time and anchorage-dependent growth, shortens the duration of G1 transit time and G1/S transition. When constituvely expressed, MCTS1 increases CDK4 and CDK6 kinases activity and CCND1/cyclin D1 protein level, as well as G1 cyclin/CDK complex formation. MCTS1 plays a role as translation enhancer, and recruits the density-regulated protein/DENR and binds to the cap complex of the 5'-terminus of mRNAs, subsequently altering the mRNA translation profile, MCTS1 up-regulates protein levels of BCL2L2, TFDP1, MRE11A, CCND1 and E2F1, while mRNA levels remains constant. MCTS1 hyperactivates DNA damage signaling pathway, increased gamma-irradiation-induced phosphorylation of histone H2AX, and induces damage foci formation.

Molekulargewicht: 20 kDa (MW of target protein)