EIF4G2 Antikörper (N-Term)

Produktnummer ABIN634222

Produktdetails anti-EIF4G2 Antikörper

Target: EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4G2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF4 G2 antibody was raised against the N terminal of EIF4 2

Aufreinigung: Affinity purified

Immunogen: EIF4 G2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4G2 Blocking Peptide, catalog no. 33R-7233, is also available for use as a blocking control in assays to test for specificity of this EIF4G2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4G2

Target: EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))

Andere Bezeichnung: EIF4G2 (EIF4G2 Produkte)

Synonyme: AAG1 antikoerper, DAP5 antikoerper, NAT1 antikoerper, P97 antikoerper, NAT1B antikoerper, eif4g2 antikoerper, hm:zeh1307 antikoerper, wu:fa14h01 antikoerper, wu:fb44h01 antikoerper, wu:fb59c06 antikoerper, wu:fc21b05 antikoerper, EIF4G2 antikoerper, AA589388 antikoerper, DAP-5 antikoerper, E130105L11Rik antikoerper, Nat1 antikoerper, Natm1 antikoerper, p97 antikoerper, NAT1A antikoerper, im:7148615 antikoerper, wu:fb81f07 antikoerper, wu:fb82b06 antikoerper, wu:fb98h08 antikoerper, dap5 antikoerper, eif4g2.L antikoerper, nat1 antikoerper, eukaryotic translation initiation factor 4 gamma 2 antikoerper, eukaryotic translation initiation factor 4, gamma 2b antikoerper, eukaryotic translation initiation factor 4, gamma 2 antikoerper, eukaryotic translation initiation factor 4 gamma, 2 antikoerper, eIF4G-related protein NAT1 antikoerper, eukaryotic translation initiation factor 4, gamma 2a antikoerper, eukaryotic translation initiation factor 4 gamma, 2 S homeolog antikoerper, EIF4G2 antikoerper, eif4g2b antikoerper, Eif4g2 antikoerper, nat1 antikoerper, eif4g2a antikoerper, eif4g2.S antikoerper

Hintergrund: Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.

Molekulargewicht: 102 kDa (MW of target protein)