DHX16 Antikörper

Produktnummer ABIN634220

Produktdetails anti-DHX16 Antikörper

Target: DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DHX16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV

Anwendungsinformationen

Applikationshinweise: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHX16 Blocking Peptide, catalog no. 33R-4749, is also available for use as a blocking control in assays to test for specificity of this DHX16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHX16

Target: DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16))

Andere Bezeichnung: DHX16 (DHX16 Produkte)

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.

Molekulargewicht: 115 kDa (MW of target protein)