ANAPC7 Antikörper (C-Term)

Produktnummer ABIN634214

Produktdetails anti-ANAPC7 Antikörper

Target: ANAPC7 (Anaphase Promoting Complex Subunit 7 (ANAPC7))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANAPC7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ANAPC7 antibody was raised against the C terminal of ANAPC7

Aufreinigung: Affinity purified

Immunogen: ANAPC7 antibody was raised using the C terminal of ANAPC7 corresponding to a region with amino acids ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANAPC7 Blocking Peptide, catalog no. 33R-1371, is also available for use as a blocking control in assays to test for specificity of this ANAPC7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANAPC7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANAPC7

Target: ANAPC7 (Anaphase Promoting Complex Subunit 7 (ANAPC7))

Andere Bezeichnung: ANAPC7 (ANAPC7 Produkte)

Synonyme: DDBDRAFT_0184417 antikoerper, DDBDRAFT_0235159 antikoerper, DDB_0184417 antikoerper, DDB_0235159 antikoerper, si:ch211-127h20.1 antikoerper, APC7 antikoerper, AW545589 antikoerper, T7F6.26 antikoerper, T7F6_26 antikoerper, anaphase promoting complex subunit 7 antikoerper, anaphase promoting complex subunit 7 L homeolog antikoerper, tetratricopeptide repeat (TPR)-containing protein antikoerper, anapc7 antikoerper, ANAPC7 antikoerper, anapc7.L antikoerper, Anapc7 antikoerper, APC7 antikoerper

Hintergrund: The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).

Molekulargewicht: 62 kDa (MW of target protein)