CCNYL1 Antikörper (N-Term)

Produktnummer ABIN634208

Der Kaninchen Polyklonal Anti-CCNYL1-Antikörper wurde für WB validiert. Er ist geeignet, CCNYL1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für CCNYL1 Antikörper (N-Term) (ABIN634208)

Target: CCNYL1 (Cyclin Y-Like 1 (CCNYL1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCNYL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCNYL1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Cyclin Y-Like 1 antibody was raised against the N terminal of CCNYL1

Aufreinigung: Affinity purified

Immunogen: Cyclin Y-Like 1 antibody was raised using the N terminal of CCNYL1 corresponding to a region with amino acids TVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cyclin Y-Like 1 Blocking Peptide, (ABIN5613065), is also available for use as a blocking control in assays to test for specificity of this Cyclin Y-Like 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNYL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCNYL1

Target: CCNYL1 (Cyclin Y-Like 1 (CCNYL1))

Andere Bezeichnung: Cyclin Y-Like 1

Hintergrund: The specific function of CCNYL1 is not yet known.

Molekulargewicht: 33 kDa (MW of target protein)