MOS Antikörper (Middle Region)

Produktnummer ABIN634201

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MOS in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für MOS Antikörper (Middle Region) (ABIN634201)

Target: MOS (Moloney Sarcoma Oncogene (MOS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MOS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MOS Antikörper

Bindungsspezifität: Middle Region

Spezifität: MOS antibody was raised against the middle region of MOS

Aufreinigung: Affinity purified

Immunogen: MOS antibody was raised using the middle region of MOS corresponding to a region with amino acids LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MOS Blocking Peptide, (ABIN5614814), is also available for use as a blocking control in assays to test for specificity of this MOS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MOS

Target: MOS (Moloney Sarcoma Oncogene (MOS))

Andere Bezeichnung: MOS

Hintergrund: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator.

Molekulargewicht: 38 kDa (MW of target protein)