RAD9B Antikörper

Produktnummer ABIN634195

Produktdetails anti-RAD9B Antikörper

Target: RAD9B (RAD9 Homolog B (RAD9B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAD9B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RAD9 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAD9B Blocking Peptide, catalog no. 33R-8859, is also available for use as a blocking control in assays to test for specificity of this RAD9B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAD9B

Target: RAD9B (RAD9 Homolog B (RAD9B))

Andere Bezeichnung: RAD9B (RAD9B Produkte)

Hintergrund: The function of RAD9B protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 28 kDa (MW of target protein)