NUP98 Antikörper (N-Term)

Produktnummer ABIN634181

Der Kaninchen Polyklonal Anti-NUP98-Antikörper wurde für WB validiert. Er ist geeignet, NUP98 in Proben von Human und Ratte zu detektieren.

Kurzübersicht für NUP98 Antikörper (N-Term) (ABIN634181)

Target: NUP98 (Nucleoporin 98kDa (NUP98))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUP98 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NUP98 Antikörper

Bindungsspezifität: N-Term

Spezifität: NUP98 antibody was raised against the N terminal of NUP98

Aufreinigung: Affinity purified

Immunogen: NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUP98 Blocking Peptide, (ABIN937760), is also available for use as a blocking control in assays to test for specificity of this NUP98 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP98 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUP98

Target: NUP98 (Nucleoporin 98kDa (NUP98))

Andere Bezeichnung: NUP98

Hintergrund: The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL).

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Stem Cell Maintenance, Protein targeting to Nucleus, SARS-CoV-2 Protein Interaktom