NUP98 Antikörper (N-Term)
-
- Target Alle NUP98 Antikörper anzeigen
- NUP98 (Nucleoporin 98kDa (NUP98))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NUP98 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NUP98 antibody was raised against the N terminal of NUP98
- Aufreinigung
- Affinity purified
- Immunogen
- NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF
- Top Product
- Discover our top product NUP98 Primärantikörper
-
anti-Nucleoporin 98kDa (NUP98) (GLFG Motif), (N-Term) antibody
NUP98 Reaktivität: Human, Maus, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Tetrahymena WB, IF Wirt: Maus Monoclonal 21A10 unconjugated
anti-Nucleoporin 98kDa (NUP98) (FGxxN Motif), (N-Term) antibodyNUP98 Reaktivität: Human, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Tetrahymena WB, IF Wirt: Maus Monoclonal 13C2 unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 1-466) antibodyNUP98 Reaktivität: Human, Maus, Ratte, Saccharomyces cerevisiae, Schizosaccharomyces pombe WB, ELISA, IF, ICC, DB Wirt: Ratte Monoclonal 2H10 unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 965-1110) antibodyNUP98 Reaktivität: Human WB, ELISA, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) antibodyNUP98 Reaktivität: Human WB, ELISA, IF, IHC Wirt: Kaninchen Monoclonal 2H4 unconjugated Recombinant Antibody
anti-Nucleoporin 98kDa (NUP98) (AA 621-920) antibodyNUP98 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) antibodyNUP98 Reaktivität: Human WB, IP Wirt: Maus Monoclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 1-606) antibodyNUP98 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) antibodyNUP98 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 1-110) antibodyNUP98 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NUP98 Blocking Peptide, catalog no. 33R-2374, is also available for use as a blocking control in assays to test for specificity of this NUP98 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP98 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUP98 (Nucleoporin 98kDa (NUP98))
- Andere Bezeichnung
- NUP98 (NUP98 Produkte)
- Hintergrund
- The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL).
- Molekulargewicht
- 98 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance, Protein targeting to Nucleus, SARS-CoV-2 Protein Interaktom
-
