KIF12 Antikörper (N-Term)

Produktnummer ABIN634175

Produktdetails anti-KIF12 Antikörper

Target: KIF12 (Kinesin Family Member 12 (KIF12))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIF12 antibody was raised against the N terminal of KIF12

Aufreinigung: Affinity purified

Immunogen: KIF12 antibody was raised using the N terminal of KIF12 corresponding to a region with amino acids SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF12 Blocking Peptide, catalog no. 33R-8585, is also available for use as a blocking control in assays to test for specificity of this KIF12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF12

Target: KIF12 (Kinesin Family Member 12 (KIF12))

Andere Bezeichnung: KIF12 (KIF12 Produkte)

Synonyme: DDBDRAFT_0189854 antikoerper, DDBDRAFT_0201555 antikoerper, DDB_0189854 antikoerper, DDB_0201555 antikoerper, RP11-56P10.3 antikoerper, kinesin family member 12 antikoerper, KIF12 antikoerper, Bm1_06740 antikoerper, kif12 antikoerper, Kif12 antikoerper

Hintergrund: KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors that play important roles in intracellular transport and cell division.

Molekulargewicht: 56 kDa (MW of target protein)