KIFC3 Antikörper (C-Term)

Produktnummer ABIN634173

Dieses Anti-KIFC3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von KIFC3 in WB. Geeignet für Human.

Kurzübersicht für KIFC3 Antikörper (C-Term) (ABIN634173)

Target: KIFC3 (Kinesin Family Member C3 (KIFC3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIFC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KIFC3 Antikörper

Bindungsspezifität: C-Term

Spezifität: KIFC3 antibody was raised against the C terminal of KIFC3

Aufreinigung: Affinity purified

Immunogen: KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIFC3 Blocking Peptide, (ABIN937838), is also available for use as a blocking control in assays to test for specificity of this KIFC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIFC3

Target: KIFC3 (Kinesin Family Member C3 (KIFC3))

Andere Bezeichnung: KIFC3

Hintergrund: KIFC3 belongs to the kinesin-like protein family. It contains 1 kinesin-motor domain. KIFC3 is the minus-end microtubule-dependent motor protein. It is involved in apically targeted transport.

Molekulargewicht: 93 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization