KIF19 Antikörper (N-Term)

Produktnummer ABIN634163

Produktdetails anti-KIF19 Antikörper

Target: KIF19 (Kinesin Family Member 19 (KIF19))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FLJ37300 antibody was raised against the N terminal Of Flj37300

Aufreinigung: Affinity purified

Immunogen: FLJ37300 antibody was raised using the N terminal Of Flj37300 corresponding to a region with amino acids EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE

Anwendungsinformationen

Applikationshinweise: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ37300 Blocking Peptide, catalog no. 33R-2807, is also available for use as a blocking control in assays to test for specificity of this FLJ37300 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ37300 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF19

Target: KIF19 (Kinesin Family Member 19 (KIF19))

Andere Bezeichnung: FLJ37300 (KIF19 Produkte)

Synonyme: KIF19A antikoerper, flj37300-a antikoerper, Kif19a antikoerper, RGD1559936 antikoerper, Kif19 antikoerper, kinesin family member 19 antikoerper, kinesin family member 19 S homeolog antikoerper, kinesin family member 19A antikoerper, KIF19 antikoerper, kif19 antikoerper, kif19.S antikoerper, Kif19 antikoerper, Kif19a antikoerper

Hintergrund: FLJ37300 is a hypothetical protein found on chromosome 17.

Molekulargewicht: 62 kDa (MW of target protein)