KIF9 Antikörper (N-Term)

Produktnummer ABIN634155

Dieses Anti-KIF9-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von KIF9 in WB. Geeignet für Human.

Kurzübersicht für KIF9 Antikörper (N-Term) (ABIN634155)

Target: KIF9 (Kinesin Family Member 9 (KIF9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KIF9 Antikörper

Bindungsspezifität: N-Term

Spezifität: KIF9 antibody was raised against the n terminal of KIF9

Aufreinigung: Affinity purified

Immunogen: KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF9 Blocking Peptide, (ABIN5614355), is also available for use as a blocking control in assays to test for specificity of this KIF9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF9

Target: KIF9 (Kinesin Family Member 9 (KIF9))

Andere Bezeichnung: KIF9

Hintergrund: KIF9 acts as a regulator of podosomes and of podosomal matrix degradation in primary human macrophages.

Molekulargewicht: 90 kDa (MW of target protein)