RPA4 Antikörper (C-Term)

Produktnummer ABIN634151

Der Kaninchen Polyklonal Anti-RPA4-Antikörper wurde für WB validiert. Er ist geeignet, RPA4 in Proben von Human zu detektieren.

Kurzübersicht für RPA4 Antikörper (C-Term) (ABIN634151)

Target: RPA4 (Replication Protein A4, 30kDa (RPA4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPA4 Antikörper

Bindungsspezifität: C-Term

Spezifität: RPA4 antibody was raised against the C terminal of RPA4

Aufreinigung: Affinity purified

Immunogen: RPA4 antibody was raised using the C terminal of RPA4 corresponding to a region with amino acids HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPA4 Blocking Peptide, (ABIN939204), is also available for use as a blocking control in assays to test for specificity of this RPA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPA4

Target: RPA4 (Replication Protein A4, 30kDa (RPA4))

Andere Bezeichnung: RPA4

Hintergrund: Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32 kDa subunit of the RPA, which associates with the 70- and 13 kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication