RPA4 Antikörper (Middle Region)
-
- Target Alle RPA4 Antikörper anzeigen
- RPA4 (Replication Protein A4, 30kDa (RPA4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPA4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPA4 antibody was raised against the middle region of RPA4
- Aufreinigung
- Affinity purified
- Immunogen
- RPA4 antibody was raised using the middle region of RPA4 corresponding to a region with amino acids VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD
- Top Product
- Discover our top product RPA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPA4 Blocking Peptide, catalog no. 33R-9743, is also available for use as a blocking control in assays to test for specificity of this RPA4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPA4 (Replication Protein A4, 30kDa (RPA4))
- Andere Bezeichnung
- RPA4 (RPA4 Produkte)
- Hintergrund
- Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32 kDa subunit of the RPA, which associates with the 70- and 13 kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation.
- Molekulargewicht
- 29 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication
-