PBK Antikörper (N-Term)

Produktnummer ABIN634145

Produktdetails anti-PBK Antikörper

Target: PBK (PDZ Binding Kinase (PBK))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PBK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PBK antibody was raised against the N terminal of PBK

Aufreinigung: Affinity purified

Immunogen: PBK antibody was raised using the N terminal of PBK corresponding to a region with amino acids SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PBK Blocking Peptide, catalog no. 33R-8581, is also available for use as a blocking control in assays to test for specificity of this PBK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PBK

Target: PBK (PDZ Binding Kinase (PBK))

Andere Bezeichnung: PBK (PBK Produkte)

Synonyme: PBK antikoerper, topk antikoerper, CT84 antikoerper, Nori-3 antikoerper, SPK antikoerper, TOPK antikoerper, 2810434B10Rik antikoerper, AW538537 antikoerper, D14Ertd732e antikoerper, zgc:92050 antikoerper, PDZ binding kinase antikoerper, PDZ binding kinase L homeolog antikoerper, PBK antikoerper, pbk antikoerper, Pbk antikoerper, pbk.L antikoerper

Hintergrund: PBK is a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.

Molekulargewicht: 36 kDa (MW of target protein)