BCAT1 Antikörper (N-Term)

Produktnummer ABIN634139

Produktdetails anti-BCAT1 Antikörper

Target: BCAT1 (Branched Chain Amino-Acid Transaminase 1, Cytosolic (BCAT1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BCAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BCAT1 antibody was raised against the N terminal of BCAT1

Aufreinigung: Affinity purified

Immunogen: BCAT1 antibody was raised using the N terminal of BCAT1 corresponding to a region with amino acids MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BCAT1 Blocking Peptide, catalog no. 33R-6125, is also available for use as a blocking control in assays to test for specificity of this BCAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BCAT1

Target: BCAT1 (Branched Chain Amino-Acid Transaminase 1, Cytosolic (BCAT1))

Andere Bezeichnung: BCAT1 (BCAT1 Produkte)

Synonyme: fj66g02 antikoerper, zgc:73157 antikoerper, wu:fj66g02 antikoerper, Bcatc antikoerper, BCATC antikoerper, BCT1 antikoerper, ECA39 antikoerper, MECA39 antikoerper, PNAS121 antikoerper, PP18 antikoerper, BCATc antikoerper, Eca39 antikoerper, branched chain amino-acid transaminase 1, cytosolic antikoerper, branched chain amino acid transaminase 1 antikoerper, branched chain amino-acid transaminase 1, cytosolic L homeolog antikoerper, branched chain aminotransferase 1, cytosolic antikoerper, bcat1 antikoerper, BCAT1 antikoerper, bcat1.L antikoerper, Bcat1 antikoerper

Hintergrund: This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth.

Molekulargewicht: 43 kDa (MW of target protein)