CDC45 Antikörper

Produktnummer ABIN634130

Der Kaninchen Polyklonal anti-CDC45 Antikörper wird verwendet zum Nachweis von CDC45 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für CDC45 Antikörper (ABIN634130)

Target: CDC45 (Cell Division Cycle 45 Homolog (S. Cerevisiae) (CDC45))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDC45 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CDC45 Antikörper

Aufreinigung: Affinity purified

Immunogen: CDC45 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDC45L Blocking Peptide, (ABIN5612777), is also available for use as a blocking control in assays to test for specificity of this CDC45L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDC45

Target: CDC45 (Cell Division Cycle 45 Homolog (S. Cerevisiae) (CDC45))

Andere Bezeichnung: CDC45L

Hintergrund: CDC45L was identified by its strong similarity with Saccharomyces cerevisiae Cdc45, an essential protein required to the initiation of DNA replication. Cdc45 is a member of the highly conserved multiprotein complex including Cdc6/Cdc18, the minichromosome maintenance proteins (MCMs) and DNA polymerase, which is important for early steps of DNA replication in eukaryotes.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA