MCM9 Antikörper (N-Term)

Produktnummer ABIN634125

Produktdetails anti-MCM9 Antikörper

Target: MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MCM9 antibody was raised against the N terminal of MCM9

Aufreinigung: Affinity purified

Immunogen: MCM9 antibody was raised using the N terminal of MCM9 corresponding to a region with amino acids NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCM9 Blocking Peptide, catalog no. 33R-6870, is also available for use as a blocking control in assays to test for specificity of this MCM9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCM9

Target: MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))

Andere Bezeichnung: MCM9 (MCM9 Produkte)

Synonyme: C6orf61 antikoerper, MCMDC1 antikoerper, dJ329L24.1 antikoerper, dJ329L24.3 antikoerper, 9030408O17Rik antikoerper, Gm235 antikoerper, Mcmdc1 antikoerper, RGD1560557 antikoerper, mcm9 antikoerper, minichromosome maintenance 9 homologous recombination repair factor antikoerper, minichromosome maintenance 9 homologous recombination repair factor L homeolog antikoerper, MCM9 antikoerper, Mcm9 antikoerper, mcm9.L antikoerper

Hintergrund: MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.

Molekulargewicht: 44 kDa (MW of target protein)