MCM9 Antikörper (N-Term)

Produktnummer ABIN634125

Der Kaninchen Polyklonal anti-MCM9 Antikörper (ABIN634125) detektiert spezifisch MCM9 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für MCM9 Antikörper (N-Term) (ABIN634125)

Target: MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MCM9 Antikörper

Bindungsspezifität: N-Term

Spezifität: MCM9 antibody was raised against the N terminal of MCM9

Aufreinigung: Affinity purified

Immunogen: MCM9 antibody was raised using the N terminal of MCM9 corresponding to a region with amino acids NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCM9 Blocking Peptide, (ABIN5614706), is also available for use as a blocking control in assays to test for specificity of this MCM9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCM9

Target: MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))

Andere Bezeichnung: MCM9

Hintergrund: MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.

Molekulargewicht: 44 kDa (MW of target protein)