KIF23 Antikörper (N-Term)

Produktnummer ABIN634117

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch KIF23 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für KIF23 Antikörper (N-Term) (ABIN634117)

Target: KIF23 (Kinesin Family Member 23 (KIF23))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KIF23 Antikörper

Bindungsspezifität: N-Term

Spezifität: KIF23 antibody was raised against the N terminal of KIF23

Aufreinigung: Affinity purified

Immunogen: KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids VRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF23 Blocking Peptide, (ABIN5614349), is also available for use as a blocking control in assays to test for specificity of this KIF23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF23

Target: KIF23 (Kinesin Family Member 23 (KIF23))

Andere Bezeichnung: KIF23

Hintergrund: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

Molekulargewicht: 98 kDa (MW of target protein)