HECA Antikörper

Produktnummer ABIN634109

Der Kaninchen Polyklonal anti-HECA Antikörper wird verwendet zum Nachweis von HECA in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für HECA Antikörper (ABIN634109)

Target: HECA (Headcase Homolog (HECA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HECA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HECA Antikörper

Aufreinigung: Affinity purified

Immunogen: HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HECA Blocking Peptide, (ABIN939152), is also available for use as a blocking control in assays to test for specificity of this HECA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HECA

Target: HECA (Headcase Homolog (HECA))

Andere Bezeichnung: HECA

Hintergrund: This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis.

Molekulargewicht: 59 kDa (MW of target protein)