HECA Antikörper

Produktnummer ABIN634109

Produktdetails anti-HECA Antikörper

Target: HECA (Headcase Homolog (HECA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HECA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HECA Blocking Peptide, catalog no. 33R-3766, is also available for use as a blocking control in assays to test for specificity of this HECA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HECA

Target: HECA (Headcase Homolog (HECA))

Andere Bezeichnung: HECA (HECA Produkte)

Synonyme: HECA antikoerper, si:dkey-34f16.2 antikoerper, HDC antikoerper, HDCL antikoerper, HHDC antikoerper, dJ225E12.1 antikoerper, Gm869 antikoerper, hdc homolog, cell cycle regulator antikoerper, Heca antikoerper, HECA antikoerper, heca antikoerper

Hintergrund: This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis.

Molekulargewicht: 59 kDa (MW of target protein)