NPM2 Antikörper (N-Term)
Kurzübersicht für NPM2 Antikörper (N-Term) (ABIN634104)
Target
Alle NPM2 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- NPM2 antibody was raised against the N terminal of NPM2
-
Aufreinigung
- Affinity purified
-
Immunogen
- NPM2 antibody was raised using the N terminal of NPM2 corresponding to a region with amino acids LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
NPM2 Blocking Peptide, (ABIN940284), is also available for use as a blocking control in assays to test for specificity of this NPM2 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPM2 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- NPM2 (Nucleophosmin/nucleoplasmin 2 (NPM2))
-
Andere Bezeichnung
- NPM2
-
Hintergrund
- NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.
-
Molekulargewicht
- 24 kDa (MW of target protein)
Target
-