RAN Antikörper (Middle Region)

Produktnummer ABIN634102

Produktdetails anti-RAN Antikörper

Target: RAN (RAN, Member RAS Oncogene Family (RAN))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Ran antibody was raised against the middle region of RAN

Aufreinigung: Affinity purified

Immunogen: Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ran Blocking Peptide, catalog no. 33R-6771, is also available for use as a blocking control in assays to test for specificity of this Ran antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAN

Target: RAN (RAN, Member RAS Oncogene Family (RAN))

Andere Bezeichnung: Ran (RAN Produkte)

Synonyme: ARA24 antikoerper, Gsp1 antikoerper, TC4 antikoerper, ran antikoerper, ara24 antikoerper, gsp1 antikoerper, ran-1 antikoerper, tc4 antikoerper, RAN antikoerper, RANP1 antikoerper, AAF30287 antikoerper, CG1404 antikoerper, Dmel\CG1404 antikoerper, Ran antikoerper, dran antikoerper, l(1)G0075 antikoerper, ran10A antikoerper, fc16b04 antikoerper, wu:fc16b04 antikoerper, RAN, member RAS oncogene family antikoerper, RAN, member RAS oncogene family S homeolog antikoerper, CG1404 gene product from transcript CG1404-RC antikoerper, RAN antikoerper, Ran antikoerper, ran.S antikoerper, ran antikoerper

Hintergrund: RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Regulatorische RNA Pathways, Intracellular Steroid Hormone Receptor Signaling Pathway, Protein targeting to Nucleus