RAN Antikörper (Middle Region)
-
- Target Alle RAN Antikörper anzeigen
- RAN (RAN, Member RAS Oncogene Family (RAN))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund, Drosophila melanogaster, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Ran antibody was raised against the middle region of RAN
- Aufreinigung
- Affinity purified
- Immunogen
- Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA
- Top Product
- Discover our top product RAN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Ran Blocking Peptide, catalog no. 33R-6771, is also available for use as a blocking control in assays to test for specificity of this Ran antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAN (RAN, Member RAS Oncogene Family (RAN))
- Andere Bezeichnung
- Ran (RAN Produkte)
- Hintergrund
- RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex.
- Molekulargewicht
- 24 kDa (MW of target protein)
- Pathways
- Regulatorische RNA Pathways, Intracellular Steroid Hormone Receptor Signaling Pathway, Protein targeting to Nucleus
-