RAN Antikörper (Middle Region)

Produktnummer ABIN634102

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RAN in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte, Hund, Drosophila melanogaster und C. elegans.

Kurzübersicht für RAN Antikörper (Middle Region) (ABIN634102)

Target: RAN (RAN, Member RAS Oncogene Family (RAN))

Reaktivität: Human, Maus, Ratte, Hund, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAN Antikörper

Bindungsspezifität: Middle Region

Spezifität: Ran antibody was raised against the middle region of RAN

Aufreinigung: Affinity purified

Immunogen: Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ran Blocking Peptide, (ABIN5615752), is also available for use as a blocking control in assays to test for specificity of this Ran antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAN

Target: RAN (RAN, Member RAS Oncogene Family (RAN))

Andere Bezeichnung: Ran

Hintergrund: RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Regulatorische RNA Pathways, Intracellular Steroid Hormone Receptor Signaling Pathway, Protein targeting to Nucleus