Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

NCAPH Antikörper (N-Term)

Dieses Anti-NCAPH-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NCAPH in WB. Geeignet für Human, Ratte und Maus.
Produktnummer ABIN634092

Kurzübersicht für NCAPH Antikörper (N-Term) (ABIN634092)

Target

Alle NCAPH Antikörper anzeigen
NCAPH (Non-SMC Condensin I Complex, Subunit H (NCAPH))

Reaktivität

  • 38
  • 21
  • 7
  • 4
  • 4
  • 4
  • 3
  • 3
  • 3
  • 3
  • 2
Human, Ratte, Maus

Wirt

  • 48
  • 4
  • 1
Kaninchen

Klonalität

  • 50
  • 3
Polyklonal

Konjugat

  • 27
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser NCAPH Antikörper ist unkonjugiert

Applikation

  • 44
  • 20
  • 13
  • 13
  • 5
  • 4
  • 4
  • 3
  • 3
  • 2
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 15
    • 7
    • 6
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    NCAPH antibody was raised against the N terminal of NCAPH

    Aufreinigung

    Affinity purified

    Immunogen

    NCAPH antibody was raised using the N terminal of NCAPH corresponding to a region with amino acids MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    NCAPH Blocking Peptide, (ABIN5614924), is also available for use as a blocking control in assays to test for specificity of this NCAPH antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPH antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    NCAPH (Non-SMC Condensin I Complex, Subunit H (NCAPH))

    Andere Bezeichnung

    NCAPH

    Hintergrund

    NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

    Molekulargewicht

    82 kDa (MW of target protein)
Sie sind hier:
Chat with us!