SMC4 Antikörper (Middle Region)

Produktnummer ABIN634091

Der Kaninchen Polyklonal anti-SMC4 Antikörper wird verwendet zum Nachweis von SMC4 in Proben von Human und Ratte. Er wurde validiert für WB.

Kurzübersicht für SMC4 Antikörper (Middle Region) (ABIN634091)

Target: SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SMC4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SMC4 antibody was raised against the middle region of SMC4

Aufreinigung: Affinity purified

Immunogen: SMC4 antibody was raised using the middle region of SMC4 corresponding to a region with amino acids EARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMC4 Blocking Peptide, (ABIN937666), is also available for use as a blocking control in assays to test for specificity of this SMC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMC4

Target: SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))

Andere Bezeichnung: SMC4

Hintergrund: SMC4 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Molekulargewicht: 147 kDa (MW of target protein)